PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g08650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 244aa    MW: 27633.8 Da    PI: 5.0644
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g08650genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.64.9e-194394556
                SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                ++ft+eq++ Le+ Fe + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  CA08g08650 43 RRFTDEQIKSLETIFETETKLEPRKKLQLARELGLQPRQVAIWFQNKRARWK 94
                48*************************************************9 PP

2HD-ZIP_I/II124.26.1e-4042132393
  HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                   rr+++eq+k+LE+ Fe+e+kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE+dy+ Lk++yd+l+++ e+L+ke+++L  +l++
   CA08g08650  42 ARRFTDEQIKSLETIFETETKLEPRKKLQLARELGLQPRQVAIWFQNKRARWKSKQLERDYSILKSNYDNLASQYESLKKEKQSLLIQLQK 132
                  69***********************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-192198IPR009057Homeodomain-like
PROSITE profilePS5007116.6173696IPR001356Homeobox domain
SMARTSM003897.6E-1639100IPR001356Homeobox domain
CDDcd000869.93E-164397No hitNo description
Gene3DG3DSA:1.10.10.608.5E-2043103IPR009057Homeodomain-like
PfamPF000461.8E-164394IPR001356Homeobox domain
PRINTSPR000311.0E-56776IPR000047Helix-turn-helix motif
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
PRINTSPR000311.0E-57692IPR000047Helix-turn-helix motif
PfamPF021831.1E-1696136IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MFDVGEFSPT SSAALSAECF SSSSCFSSPS SSKKKKINSN NARRFTDEQI KSLETIFETE  60
TKLEPRKKLQ LARELGLQPR QVAIWFQNKR ARWKSKQLER DYSILKSNYD NLASQYESLK  120
KEKQSLLIQL QKLNDVMKKD SIGLDSDKRA DAIKKNIEMD GRPSLSFDLS EHGANGVISD  180
DDSCIKPNYL GLNEDTDHHL LKMVEAGDSS LTSPENWGSL DEDGLLDQQP SSTTYDQWWD  240
FWS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAPTransfer from AT2G46680Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-118HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016538251.11e-179PREDICTED: homeobox-leucine zipper protein ATHB-12-like
RefseqXP_016538252.11e-179PREDICTED: homeobox-leucine zipper protein ATHB-12-like
SwissprotP468973e-65ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLK4B0201e-118K4B020_SOLLC; Uncharacterized protein
STRINGSolyc01g096320.2.11e-118(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20412363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61890.15e-63homeobox 12